Sequence Browser (Q9BQ52-1)

UniProt (Ref Seq)
Displayed Structure
Experimental Tertiary/Complex (PDB:XRay/EM)
Experimental Tertiary/Complex (PDB:NMR)
Modelled Tertiary (Phyre)
If the whole structure is coloured grey in '3D Structure Viewer' panel, please click the icon - on the top left corner of the viewer.
(If nothing changes then 'Sequence ↔ Structure' mapping may be unavailable).
1
826
Isoform
Remark
Ref
No experimental confirmation available.
VSP_009168 VSP_009170
No experimental confirmation available.
VSP_043449
Q9BQ52-1  
No experimental confirmation available.
VSP_009169 VSP_009171 VSP_009172
Click on Isoform of interest to be redirected to the corresponding page
Type
Variation
Position
splice variant
Missing
1 - 372
splice variant
Missing
188 - 227
splice variant
GLPSILLQRERALASLGKPLHPLLVVAPNQLKAWLQQYHNQC → VSVGLDHKAGAWRRHCHVELALWLRLFLRFQTCPELLLLISG
554 - 595
sequence variant
S → F
52
sequence variant
R → Q
211
sequence variant
L → F
423
sequence variant
G → R
487
sequence variant
A → T
541
sequence variant
S → L
627
sequence variant
G → R
806
sequence conflict
Missing
406
sequence conflict
F → L
754
splice variant
Missing
1 - 94
splice variant
NCASVHNLRSHKIQTQLNLIHPDIFPLLTSFRCK → MRTVPQFTTFAATRFKPSSTSSTRTSSPCSPVSA
373 - 406
splice variant
Missing
596 - 826
sequence variant
F → L
154
sequence variant
S → L
217
sequence variant
D → N
436
sequence variant
T → I
520
sequence variant
E → V
622
sequence variant
R → H
781
sequence conflict
V → M
165
sequence conflict
H → Y
592

To analyse the structural impact of your missense variant:

  • Select the corresponding experimental/modelled structure from the "Available Structures" Panel.
  • Right-click on the target structure and download it.
  • Go to our web server Missense3D to analyse structural impact.

  • Go to Missense3D
Protein:
Other Names:
ElaC homolog protein 2, Heredity prostate cancer protein 2, Ribonuclease Z 2, tRNA 3 endonuclease 2, tRNase Z 2
Primary Accession:
Other Accessions:
B4DPL9, Q6IA94, Q9HAS8, Q9HAS9, Q9NVT1
Gene :
ELAC2*, synonyms (HPC2)
Organism :
Human
Entry Name :
Length :
826
Mass (Da) :
92,219
Last modified :
Jan 16, 2004
Version :
v2
Isoforms :
4 
Variants :
23 
Interactions :
0 
Structures :
Experimental 0 | Phyre prediction 2

Zinc phosphodiesterase, which displays mitochondrial tRNA 3'-processing endonuclease activity. Involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA.

No interactions reported for this protein.