Sequence Browser (Q9NZC7-1)

UniProt (Ref Seq)
Displayed Structure
Experimental Tertiary/Complex (PDB:XRay/EM)
Experimental Tertiary/Complex (PDB:NMR)
Modelled Tertiary (Phyre)
If the whole structure is coloured grey in '3D Structure Viewer' panel, please click the icon - on the top left corner of the viewer.
(If nothing changes then 'Sequence ↔ Structure' mapping may be unavailable).
1
414
Isoform
Remark
Ref
VSP_016358 VSP_016359
VSP_016363
VSP_016362 VSP_016366
Q9NZC7-1  
VSP_016367 VSP_016369
Variant in position: 182:K->E (found in a primary colorectal tumor and tumor cells).
VSP_016364 VSP_016365
VSP_016360
Click on Isoform of interest to be redirected to the corresponding page
Type
Variation
Position
splice variant
Missing
37 - 414
splice variant
FETAKSFALHGAHVILACRNMARASEAVSRILEEWHKAKVEAMTLDLALLRSVQHFAEAFKAKNVPLHVLVCNAAT → KASCHVGRTLKHTRVEELSLLPTAINRELPPPCTVLLSQNWRVWEGCTSTTAAAACPHQKLRAKRRPGPCGRSARG
138 - 213
splice variant
HKAKVEAMTLDLALLRS → KTKYHPPPEKCRIKIFH
173 - 189
splice variant
Missing
214 - 414
splice variant
Missing
364 - 414
sequence variant
P → T
47
sequence variant
T → S
111
splice variant
N → K
36
splice variant
GFETAKSFALHGAHVILACRNMARASEAVSRILEEWHKAKVEAMTLDLALLRSVQHFAEAFKAKNVPLHVLVCNAATFALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSAPARVIVVSSESHRFTDINDSLGKLDFSRLSPTKNDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPGNMMYSNIHRSWWVYTLLFTLARPFTKSMQQGAATTVYCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALSERLIQERLGSQSG → ATGSCHHRVLCCCPRTGGSGRDVLQQLLPLHALTRSSERRDGPDPVGAQREADPRTAWQPVRLSGAQSGWAHTPALCVSPHASARAGPLPNVPPTQIRKSKGNKSSHNRVKNLKYQWEAGNSWGKVSLFWGWARHRSLCFLVVACLKVKTCLVCRFRISLEKHQQFSFFYCYRIA
137 - 414
splice variant
Missing
173 - 352
splice variant
Missing
190 - 414
splice variant
QQGAATTVYCA → VSDCLVEGGHF
353 - 363
sequence variant
P → R
47
sequence variant
P → L
98
sequence variant
R → W
120
sequence variant
L → V
216
sequence variant
P → A
282
sequence variant
R → H
314
mutagenesis site
K → T
28
mutagenesis site
Y → F
33
mutagenesis site
WEHP → FEHA
44 - 47
mutagenesis site
YLDP → ALDA
85 - 88
sequence variant
A → T
179
sequence variant
L → F
272
sequence variant
L → P
291
sequence variant
G → R
372
mutagenesis site
D → V
29
mutagenesis site
Y → R
33
mutagenesis site
Y → R
61
mutagenesis site
Y → A
287

To analyse the structural impact of your missense variant:

  • Select the corresponding experimental/modelled structure from the "Available Structures" Panel.
  • Right-click on the target structure and download it.
  • Go to our web server Missense3D to analyse structural impact.

  • Go to Missense3D
Protein:
Other Names:
Fragile site FRA16D oxidoreductase, Short chain dehydrogenase/reductase family 41C member 1
Primary Accession:
Other Accessions:
A8K323, Q5MYT5, Q96KM3, Q96RF2, Q9BTT8, Q9NPC9, Q9NRF4, Q9NRF5, Q9NRF6, Q9NRK1, Q9NZC5
Gene :
WWOX*, synonyms (FOR, SDR41C1, WOX1)
Organism :
Human
Entry Name :
Length :
414
Mass (Da) :
46,677
Last modified :
Jan 1, 2000
Version :
v1
Isoforms :
7 
Variants :
30 
Interactions :
18 
Structures :
Experimental 1 | Phyre prediction 5

Putative oxidoreductase. Acts as a tumor suppressor and plays a role in apoptosis. Required for normal bone development (By similarity). May function synergistically with p53/TP53 to control genotoxic stress-induced cell death. Plays a role in TGFB1 signaling and TGFB1-mediated cell death. May also play a role in tumor necrosis factor (TNF)-mediated cell death. Inhibits Wnt signaling, probably by sequestering DVL2 in the cytoplasm.

With
Entry
IntAct
Exp
Bcl9l
Q67FY2
EBI-4320739, EBI-5234367
3
CSNK2B
P67870
EBI-12040603, EBI-348169
4
DAZAP2
Q15038
EBI-12040603, EBI-724310
6
ENKD1
Q9H0I2
EBI-12040603, EBI-744099
4
FAM189B
P81408
EBI-4320739, EBI-6366314
2
KRTAP11-1
Q8IUC1
EBI-12040603, EBI-1052037
4
LITAF
Q99732
EBI-4320739, EBI-725647
5
MKRN3
Q13064
EBI-12040603, EBI-2340269
4
WBP1
Q96G27
EBI-4320739, EBI-3867685
3
ANAPC11
Q9NYG5-2
EBI-12040603, EBI-12224467
4
C10orf55
Q5SWW7
EBI-12040603, EBI-12809220
4
CTAG1B
P78358
EBI-12040603, EBI-1188472
4
Dvl2
Q60838
EBI-4320739, EBI-641940
2
Erbb4
Q61527
EBI-4320739, EBI-4398741
3
HOXA1
P49639
EBI-12040603, EBI-740785
4
LINC01600
Q96MT4
EBI-12040603, EBI-12804988
4
MED25
Q71SY5
EBI-12040603, EBI-394558
4
SHISA5
Q8N114
EBI-4320739, EBI-2115556
2